McDonnell Genome Institute

Washington University

Transcript

lnc-TSHZ1-4:7

Chromosome

chr18

Gene Name

lnc-TSHZ1-4

Start

75455673

CPC Label

noncoding

End

75479707

Cancer

HCC

Strand

+

Peptide

LQSYDGLK

Modified Peptide

LQSYDGLK

Peptide Length

8

ORF Length

85

Open Reading Frame (ORF)

LQSYDGLKLFLPFCLTLLTCCPLHIAPDDSPSYPHSSQWEGEMELVKACSSFSCALQLCTVHLFLPHWPECSHLASTGCKEGWGL

Conservation Score

0.439

PhyloCSF Frame 1

-4.932

No. of Spectra

8

CPC Coding Probability

0.0518777

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9994

PhyloCSF Frame 3

0

CNTI Score

-0.358802736