McDonnell Genome Institute

Washington University

Transcript

lnc-TSHZ1-4:6

Chromosome

chr18

Gene Name

lnc-TSHZ1-4

Start

75455673

CPC Label

noncoding

End

75469071

Cancer

EOGC

Strand

+

Peptide

LDSETPFK

Modified Peptide

n[145]LDSETPFK

Peptide Length

8

ORF Length

52

Open Reading Frame (ORF)

LDSETPFKMHSFPPAQGLGIQTQSLPQTLSRLSLAWWAQEGFKIISSFMSIR

Conservation Score

0.088

PhyloCSF Frame 1

-1.129

No. of Spectra

3

CPC Coding Probability

0.068924

PhyloCSF Frame 2 

-4.111

CNTI Index

noncoding

Max Probability

0.9828

PhyloCSF Frame 3

-5.594

CNTI Score

-0.357680351