McDonnell Genome Institute

Washington University

Transcript

lnc-TSHB-5:2

Chromosome

chr1

Gene Name

lnc-TSHB-5

Start

114901194

CPC Label

noncoding

End

114904181

Cancer

LUAD

Strand

+

Peptide

LLLHIYYK

Modified Peptide

n[230]LLLHIYYK

Peptide Length

8

ORF Length

39

Open Reading Frame (ORF)

LLLHIYYKNQLAMFVWVYFWTLLHFLGVFVYSFANIAVS

Conservation Score

0.873

PhyloCSF Frame 1

0

No. of Spectra

10

CPC Coding Probability

0.0313568

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9954

PhyloCSF Frame 3

0

CNTI Score

-0.454539689