McDonnell Genome Institute

Washington University

Transcript

lnc-TSHB-2:4

Chromosome

chr1

Gene Name

lnc-TSHB-2

Start

115179872

CPC Label

noncoding

End

115233062

Cancer

OV

Strand

+

Peptide

QSLVQARMHIPHQAARPRGGPTLVALNPCGGGNGLVK

Modified Peptide

n[145]QSLVQARMHIPHQAARPRGGPTLVALNPCGGGNGLVK

Peptide Length

37

ORF Length

162

Open Reading Frame (ORF)

LSGCSKHPMEKARTVGLELTGEVEQAGKQSLVQARMHIPHQAARPRGGPTLVALNPCGGGNGLVKIVTMCFVFVPEGPGTTLWHNEGIESQQSPRLGVLTRCQDPERQELSPCHEGAESCGLSPWKYHQKKLFRAKCIPCVGLAHVFLVNEADLPGFRRVSV

Conservation Score

1

PhyloCSF Frame 1

-1.818

No. of Spectra

1

CPC Coding Probability

0.466068

PhyloCSF Frame 2 

-3.868

CNTI Index

noncoding

Max Probability

0.1606

PhyloCSF Frame 3

-3.688

CNTI Score

-0.354766448