McDonnell Genome Institute

Washington University

Transcript

lnc-TSC22D2-8:1

Chromosome

chr3

Gene Name

lnc-TSC22D2-8

Start

150240338

CPC Label

noncoding

End

150243142

Cancer

CCRC

Strand

+

Peptide

FVQGLLLGSLDIIQR

Modified Peptide

n[230]FVQGLLLGSLDIIQR

Peptide Length

15

ORF Length

66

Open Reading Frame (ORF)

LGLHCARPPQEFSKWRISGGNITPDSSEVSTFKFVQGLLLGSLDIIQRVHRLVGLEEESLFPLTSL

Conservation Score

0.217

PhyloCSF Frame 1

0

No. of Spectra

60

CPC Coding Probability

0.0456342

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9973

PhyloCSF Frame 3

0

CNTI Score

-0.38873911