McDonnell Genome Institute

Washington University

Transcript

lnc-TSC22D1-4:1

Chromosome

chr13

Gene Name

lnc-TSC22D1-4

Start

44369364

CPC Label

noncoding

End

44369877

Cancer

EOGC

Strand

-

Peptide

ALDVWLYR

Modified Peptide

n[145]ALDVWLYR

Peptide Length

8

ORF Length

43

Open Reading Frame (ORF)

MPSQFSAFRARNPNKPMPINHKSAPLRALDVWLYRLSFTHLYK

Conservation Score

0.928

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.254798

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9998

PhyloCSF Frame 3

0

CNTI Score

-0.403050586