McDonnell Genome Institute

Washington University

Transcript

lnc-TSC22D1-2:2

Chromosome

chr13

Gene Name

lnc-TSC22D1-2

Start

44370210

CPC Label

noncoding

End

44373841

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

FLEGGVLR

Modified Peptide

n[145]FLEGGVLR

Peptide Length

8

ORF Length

67

Open Reading Frame (ORF)

LLSSGEQNIRFLEGGVLREDMEAPQPFPHFLPCASLPSHCSSICFVISFLINEQTEVKCFTEFCDPL

Conservation Score

0.202

PhyloCSF Frame 1

0

No. of Spectra

89

CPC Coding Probability

0.121472

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9972

PhyloCSF Frame 3

0

CNTI Score

-0.277037449