McDonnell Genome Institute

Washington University

Transcript

lnc-TRUB2-2:1

Chromosome

chr9

Gene Name

lnc-TRUB2-2

Start

128450830

CPC Label

noncoding

End

128452052

Cancer

OV

Strand

-

Peptide

AISQEQLHPLR

Modified Peptide

n[145]AISQEQLHPLR

Peptide Length

11

ORF Length

174

Open Reading Frame (ORF)

LRAISQEQLHPLRGDAGATGQGSHLENHRSILQTHRPPRSSEAISLSDLCILHLPSPHGELRGTPALAKMELMVYTETSRSMCISENKGNLRNSLAPNTQTTQTRNSVHPPLVSRVSTSGAQGLGLGQDLQPLQLWEPSRPSSDAPSSMRPAVAPTSQDALMAPSWVWVPISLL

Conservation Score

0.871

PhyloCSF Frame 1

0

No. of Spectra

13

CPC Coding Probability

0.383815

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4191

PhyloCSF Frame 3

0

CNTI Score

-0.375481954