McDonnell Genome Institute

Washington University

Transcript

lnc-TRPS1-3:1

Chromosome

chr8

Gene Name

lnc-TRPS1-3

Start

114791652

CPC Label

noncoding

End

114791929

Cancer

OV

Strand

-

Peptide

ALYLIQMWK

Modified Peptide

n[145]ALYLIQM[147]WK

Peptide Length

9

ORF Length

45

Open Reading Frame (ORF)

MALYLIQMWKIFEAIEEEDSLGFTVKGPAMILNLQSTIMCYLQVL

Conservation Score

0.062

PhyloCSF Frame 1

-4.666

No. of Spectra

1

CPC Coding Probability

0.0780596

PhyloCSF Frame 2 

-5.082

CNTI Index

noncoding

Max Probability

0.5399

PhyloCSF Frame 3

-3.583

CNTI Score

-0.442316248