McDonnell Genome Institute

Washington University

Transcript

lnc-TRPM1-1:22

Chromosome

chr15

Gene Name

lnc-TRPM1-1

Start

31214239

CPC Label

noncoding

End

31229382

Cancer

OV

Strand

-

Peptide

APPDGSHLLGGGR

Modified Peptide

n[145]APPDGSHLLGGGR

Peptide Length

13

ORF Length

250

Open Reading Frame (ORF)

LEADVHFAHFNISSPAGLGPGKRQGCGFPPPLPQPFSPAPLLLLPPLLPLLLSRTPPFFLAHLSALLAPFFCPSPSASPFPSASPSPSPGPLPPVPPPCPPPPPRGPRPGNLARPGRLRWGARGGSGAHPLRLPRAPPDGSHLLGGGRWILGLGLRRQEGKWVSAGPRQGCCCAWKGARGAGGLSQARRQERPRVTLQAQRGRAAACTGARACGERLSGAARMDCVPLPGHGSGRRGPGALLSPSDVPKA

Conservation Score

0.494

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.162582

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6654

PhyloCSF Frame 3

0.209

CNTI Score

-0.248244166