McDonnell Genome Institute

Washington University

Transcript

lnc-TRMT61B-5:6

Chromosome

chr2

Gene Name

lnc-TRMT61B-5

Start

28394161

CPC Label

noncoding

End

28395522

Cancer

OV

Strand

-

Peptide

DVSSPTRPPLPSAGLLAPGTPRPSR

Modified Peptide

n[145]DVSSPTRPPLPSAGLLAPGTPRPSR

Peptide Length

25

ORF Length

111

Open Reading Frame (ORF)

LVFINTEITRTIPPVQTSPAALETSCFLLPEPPRSLRDVSSPTRPPLPSAGLLAPGTPRPSRCSFVPGGQCSLLSVILTEDGSAGGQAGRQGAHRRHEPTKAGFFLPDLRT

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.0463259

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6662

PhyloCSF Frame 3

0

CNTI Score

-0.336392908