McDonnell Genome Institute

Washington University

Transcript

lnc-TRMT61B-5:3

Chromosome

chr2

Gene Name

lnc-TRMT61B-5

Start

28383026

CPC Label

coding

End

28412029

Cancer

BRCA-Luminal A

Strand

-

Peptide

CACVLCPGGSGEK

Modified Peptide

n[145]CACVLCPGGSGEK

Peptide Length

13

ORF Length

57

Open Reading Frame (ORF)

LRNIAPNQWKVTITTTIIIRCACVLCPGGSGEKCQLPTPGKHPTFKFHFSPQARFWV

Conservation Score

1

PhyloCSF Frame 1

-1.783

No. of Spectra

1

CPC Coding Probability

0.761128

PhyloCSF Frame 2 

-3.186

CNTI Index

noncoding

Max Probability

0.1392

PhyloCSF Frame 3

-4.61

CNTI Score

-0.318252583