McDonnell Genome Institute

Washington University

Transcript

lnc-TRMT61B-1:16

Chromosome

chr2

Gene Name

lnc-TRMT61B-1

Start

28731215

CPC Label

noncoding

End

28736231

Cancer

OSCC

Strand

-

Peptide

MALYFINQSIITLININQFLR

Modified Peptide

n[145]MALYFINQSIITLININQFLR

Peptide Length

21

ORF Length

53

Open Reading Frame (ORF)

MALYFINQSIITLININQFLRASSLLNKWRTMSFMNLQSLGPAHILRPHLCFP

Conservation Score

0.573

PhyloCSF Frame 1

-5.506

No. of Spectra

10

CPC Coding Probability

0.0719237

PhyloCSF Frame 2 

-3.923

CNTI Index

noncoding

Max Probability

0.8926

PhyloCSF Frame 3

-5.364

CNTI Score

-0.378143003