McDonnell Genome Institute

Washington University

Transcript

lnc-TRMT112-4:1

Chromosome

chr11

Gene Name

lnc-TRMT112-4

Start

64301851

CPC Label

noncoding

End

64305233

Cancer

OSCC

Strand

-

Peptide

ASFSMSSIRGSGSWRSSK

Modified Peptide

n[145]ASFSM[147]SSIRGSGSWRSSK

Peptide Length

18

ORF Length

135

Open Reading Frame (ORF)

LGPSPAKSTRICRGSSWGLAGSLLRRALVRISRASFSMSSIRGSGSWRSSKRLRRPGTSSLPTAEMPPPPPCGPQTPNQPACPSTLPTTPNFHILSTPNLPIPYPTETPSLPSPSNPALLLCPVGSMGHVLRNIE

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0946407

PhyloCSF Frame 2 

0.037

CNTI Index

noncoding

Max Probability

0.2958

PhyloCSF Frame 3

6.202

CNTI Score

-0.304032157