McDonnell Genome Institute

Washington University

Transcript

lnc-TRMT112-2:4

Chromosome

chr11

Gene Name

lnc-TRMT112-2

Start

64394347

CPC Label

noncoding

End

64395831

Cancer

OV

Strand

-

Peptide

EATLQPSGALHLRPSMVR

Modified Peptide

n[145]EATLQPSGALHLRPSM[147]VR

Peptide Length

18

ORF Length

106

Open Reading Frame (ORF)

LRHGNCLNPGDRGCSEPRSRHCTPGLYQVHSKSGEEPSGLQLPPREATLQPSGALHLRPSMVRHCRGRGLDLNSSGLCLRGRKVLHFWTSIMGAPVYLAAVLCCRF

Conservation Score

0.136

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.251915

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9802

PhyloCSF Frame 3

0

CNTI Score

-0.351475878