McDonnell Genome Institute

Washington University

Transcript

lnc-TRMT11-2:2

Chromosome

chr6

Gene Name

lnc-TRMT11-2

Start

126171699

CPC Label

noncoding

End

126177522

Cancer

OV

Strand

+

Peptide

LPQPPEYLGLR

Modified Peptide

n[145]LPQPPEYLGLR

Peptide Length

11

ORF Length

39

Open Reading Frame (ORF)

LPQPPEYLGLRAACYHAQLIFVFLVEKGFIILARLVSNS

Conservation Score

0.088

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0467388

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7275

PhyloCSF Frame 3

0

CNTI Score

-0.37500431