McDonnell Genome Institute

Washington University

Transcript

lnc-TRMO-1:1

Chromosome

chr9

Gene Name

lnc-TRMO-1

Start

97897752

CPC Label

noncoding

End

97901841

Cancer

OV

Strand

-

Peptide

LRQKDCLSPGVQGCK

Modified Peptide

n[145]LRQKDCLSPGVQGCK

Peptide Length

15

ORF Length

36

Open Reading Frame (ORF)

LRQKDCLSPGVQGCKEFKAMIMPLSSSLGNRARPHI

Conservation Score

0.074

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0359392

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3239

PhyloCSF Frame 3

0

CNTI Score

-0.391492491