McDonnell Genome Institute

Washington University

Transcript

lnc-TRIQK-3:1

Chromosome

chr8

Gene Name

lnc-TRIQK-3

Start

93215924

CPC Label

noncoding

End

93234878

Cancer

EOGC

Strand

-

Peptide

SLLASLMLLK

Modified Peptide

n[145]SLLASLM[147]LLK

Peptide Length

10

ORF Length

58

Open Reading Frame (ORF)

MLAQNSFWQQILEILPVPIFRMYLAPFLHFCCLLKDHYFKRSLLASLMLLKKSPNWSC

Conservation Score

0.121

PhyloCSF Frame 1

0

No. of Spectra

50

CPC Coding Probability

0.0704613

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9983

PhyloCSF Frame 3

0

CNTI Score

-0.415210484