McDonnell Genome Institute

Washington University

Transcript

lnc-TRIQK-2:1

Chromosome

chr8

Gene Name

lnc-TRIQK-2

Start

92875220

CPC Label

noncoding

End

92879502

Cancer

OV

Strand

-

Peptide

ALHFIYTLEIR

Modified Peptide

n[145]ALHFIYTLEIR

Peptide Length

11

ORF Length

45

Open Reading Frame (ORF)

LERTYVSKALHFIYTLEIRLYVTMTVVCKNVLTASLFMTKKVKVM

Conservation Score

0.406

PhyloCSF Frame 1

-5.476

No. of Spectra

11

CPC Coding Probability

0.0550097

PhyloCSF Frame 2 

-5.223

CNTI Index

noncoding

Max Probability

0.9148

PhyloCSF Frame 3

-4.688

CNTI Score

-0.378581359