McDonnell Genome Institute

Washington University

Transcript

lnc-TRIML1-9:2

Chromosome

chr4

Gene Name

lnc-TRIML1-9

Start

188738371

CPC Label

noncoding

End

188742031

Cancer

EOGC

Strand

+

Peptide

EYANYESLVEIISQK

Modified Peptide

n[145]EYANYESLVEIISQK

Peptide Length

15

ORF Length

38

Open Reading Frame (ORF)

LHDLETFMQGDYLLDELVQSLKEYANYESLVEIISQKV

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

21

CPC Coding Probability

0.248819

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.6988

PhyloCSF Frame 3

0

CNTI Score

0.741614445