McDonnell Genome Institute

Washington University

Transcript

lnc-TRIM77-9:2

Chromosome

chr11

Gene Name

lnc-TRIM77-9

Start

89731016

CPC Label

noncoding

End

89734782

Cancer

OSCC

Strand

+

Peptide

NHQQNIIEK

Modified Peptide

n[145]NHQQNIIEK

Peptide Length

9

ORF Length

115

Open Reading Frame (ORF)

LAVCWVSWSLFLWLFIAMCLWKNHQQNIIEKYDPLGYLYQGSDINGQMVEHTTLSGANEINGNVHEGFLSQGGLSSGCSHLHHKVSNGVNATVNGSLNGGLYSGHTNSLTRTCEF

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.0514855

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.963

PhyloCSF Frame 3

0

CNTI Score

-0.298328318