McDonnell Genome Institute

Washington University

Transcript

lnc-TRIM74-1:4

Chromosome

chr7

Gene Name

lnc-TRIM74-1

Start

72947832

CPC Label

noncoding

End

72949592

Cancer

OV

Strand

-

Peptide

MPSRQLEEPGAGTPSPR

Modified Peptide

n[145]MPSRQLEEPGAGTPSPR

Peptide Length

17

ORF Length

93

Open Reading Frame (ORF)

MPSRQLEEPGAGTPSPRLVYSMCSLCQEENEDMVQDALQQNPGAFRLAPALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPT

Conservation Score

1

PhyloCSF Frame 1

9.802

No. of Spectra

1

CPC Coding Probability

0.265382

PhyloCSF Frame 2 

12.162

CNTI Index

noncoding

Max Probability

0.089

PhyloCSF Frame 3

-2.557

CNTI Score

-0.290298127