McDonnell Genome Institute

Washington University

Transcript

lnc-TRIM74-1:3

Chromosome

chr7

Gene Name

lnc-TRIM74-1

Start

72944708

CPC Label

coding

End

72954250

Cancer

CCRC

Strand

-

Peptide

LFLAGAK

Modified Peptide

n[230]LFLAGAK

Peptide Length

7

ORF Length

46

Open Reading Frame (ORF)

LCFLQKGKGPRAATAPWRLKPEIRGRFALRNWKGPRLFLAGAKVQI

Conservation Score

1

PhyloCSF Frame 1

-3.97

No. of Spectra

36

CPC Coding Probability

0.5401

PhyloCSF Frame 2 

1.027

CNTI Index

coding

Max Probability

0.9981

PhyloCSF Frame 3

-2.451

CNTI Score

0.727678857