McDonnell Genome Institute

Washington University

Transcript

lnc-TRIM74-1:2

Chromosome

chr7

Gene Name

lnc-TRIM74-1

Start

72947580

CPC Label

noncoding

End

72954706

Cancer

EOGC

Strand

-

Peptide

ALSRGWCTPATSSLDDLRALK

Modified Peptide

n[145]ALSRGWCTPATSSLDDLRALK

Peptide Length

21

ORF Length

126

Open Reading Frame (ORF)

LRWQACWPAWRAARALSRGWCTPATSSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPRQAPMSWMPVPPQAIKTSHLAALLKNQGYAEQTAGGARGRDT

Conservation Score

1

PhyloCSF Frame 1

10.24

No. of Spectra

2

CPC Coding Probability

0.432456

PhyloCSF Frame 2 

9.627

CNTI Index

coding

Max Probability

0.7179

PhyloCSF Frame 3

-3.228

CNTI Score

0.696992104