McDonnell Genome Institute

Washington University

Transcript

lnc-TRIM71-1:1

Chromosome

chr3

Gene Name

lnc-TRIM71-1

Start

32812811

CPC Label

noncoding

End

32813851

Cancer

OV

Strand

+

Peptide

CGLTPNPR

Modified Peptide

n[145]CGLTPNPR

Peptide Length

8

ORF Length

50

Open Reading Frame (ORF)

MKKADAKSLRWKCGLTPNPRSERVTEASVTFEYKTWLQMNSRKNENVLLI

Conservation Score

0.992

PhyloCSF Frame 1

-4.909

No. of Spectra

2

CPC Coding Probability

0.029116

PhyloCSF Frame 2 

-4.2

CNTI Index

noncoding

Max Probability

0.6505

PhyloCSF Frame 3

-4.782

CNTI Score

-0.418749285