McDonnell Genome Institute

Washington University

Transcript

lnc-TRIM61-6:1

Chromosome

chr4

Gene Name

lnc-TRIM61-6

Start

165012365

CPC Label

noncoding

End

165012845

Cancer

EOGC

Strand

-

Peptide

ELMCVLSTLNTVSRDSFLK

Modified Peptide

n[145]ELM[147]CVLSTLNTVSRDSFLK

Peptide Length

19

ORF Length

75

Open Reading Frame (ORF)

LPRELMCVLSTLNTVSRDSFLKHMKENDQKKKEAKEKGTWVQLKRQPAPPREAHFVRTNGKESELLEPIPYEFMA

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.258189

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5845

PhyloCSF Frame 3

0

CNTI Score

-0.340110324