McDonnell Genome Institute

Washington University

Transcript

lnc-TRIM60-2:1

Chromosome

chr4

Gene Name

lnc-TRIM60-2

Start

165010458

CPC Label

coding

End

165011851

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

DLSVAGITGR

Modified Peptide

n[145]DLSVAGITGR

Peptide Length

10

ORF Length

65

Open Reading Frame (ORF)

LRDLSVAGITGRCKWMTSQCGPWGCVRNPCPGRESGPCQDRACAGLSSCRMVSVWPEALFLSSFR

Conservation Score

1

PhyloCSF Frame 1

-3.527

No. of Spectra

3

CPC Coding Probability

0.935425

PhyloCSF Frame 2 

9.464

CNTI Index

noncoding

Max Probability

0.996

PhyloCSF Frame 3

-3.481

CNTI Score

-0.311172005