McDonnell Genome Institute

Washington University

Transcript

lnc-TRIM55-1:8

Chromosome

chr8

Gene Name

lnc-TRIM55-1

Start

66112666

CPC Label

noncoding

End

66114779

Cancer

OV

Strand

+

Peptide

RDSSEAK

Modified Peptide

n[145]RDSSEAK

Peptide Length

7

ORF Length

120

Open Reading Frame (ORF)

LPAGGVPRPSGPSLHPAGVGPVALVRPPGLKVQRTLQKSKLLAFAVWGRQRRDSSEAKLPIVRGDPQGKQNKKQRTWKRTLITLNVCSTEEAGTVRPHLKSAGRTAWLWADPRWIGQGKR

Conservation Score

0.788

PhyloCSF Frame 1

-1.807

No. of Spectra

6

CPC Coding Probability

0.0406818

PhyloCSF Frame 2 

-3.56

CNTI Index

noncoding

Max Probability

0.994

PhyloCSF Frame 3

0

CNTI Score

-0.359693569