McDonnell Genome Institute

Washington University

Transcript

lnc-TRIM49B-9:1

Chromosome

chr11

Gene Name

lnc-TRIM49B-9

Start

49432409

CPC Label

noncoding

End

49434524

Cancer

HCC

Strand

+

Peptide

LGKQSSIK

Modified Peptide

LGKQSSIK

Peptide Length

8

ORF Length

75

Open Reading Frame (ORF)

LGKQSSIKGEVAFFLEHQARRLDKRLVLGALFPEPRPYNFVWISNAGGTALRKSSSCHKSKKTCGIFLSPICRRG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0216906

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.2064

PhyloCSF Frame 3

0

CNTI Score

-0.343806286