McDonnell Genome Institute

Washington University

Transcript

lnc-TRIM49B-5:1

Chromosome

chr11

Gene Name

lnc-TRIM49B-5

Start

48893255

CPC Label

coding

End

48898703

Cancer

OV

Strand

+

Peptide

GLQGGVLTAR

Modified Peptide

n[145]GLQGGVLTAR

Peptide Length

10

ORF Length

163

Open Reading Frame (ORF)

MTSTMALQAVLGRSQQKSTGVETKDQAHRNRDPRGLQGGVLTARLPHTCWLGRLFKMQVSLELFCGHQEHYLTSPVLAPRYPVHLGKDGTHWEQGPNTPTPEQRGTWGNRQLFAVLPLLFCTSLETMSIGYSVVVAGQVATHQGSDATSARAKLPDTGCSNDN

Conservation Score

0.746

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.88137

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6246

PhyloCSF Frame 3

0

CNTI Score

-0.346681226