McDonnell Genome Institute

Washington University

Transcript

lnc-TRIM45-1:12

Chromosome

chr1

Gene Name

lnc-TRIM45-1

Start

117023491

CPC Label

noncoding

End

117059897

Cancer

OV

Strand

-

Peptide

DLTKINNMYAMK

Modified Peptide

n[145]DLTKINNM[147]YAMK

Peptide Length

12

ORF Length

61

Open Reading Frame (ORF)

LVYLLKTVYLFYKDLTKINNMYAMKDPICLREDTLFITDCILFTVLIYLFYCKNCRFYRAY

Conservation Score

0.998

PhyloCSF Frame 1

-5.604

No. of Spectra

30

CPC Coding Probability

0.122283

PhyloCSF Frame 2 

-3.928

CNTI Index

noncoding

Max Probability

0.6829

PhyloCSF Frame 3

-4.43

CNTI Score

-0.364036148