McDonnell Genome Institute

Washington University

Transcript

lnc-TRIM44-1:1

Chromosome

chr11

Gene Name

lnc-TRIM44-1

Start

35656226

CPC Label

noncoding

End

35661339

Cancer

HCC

Strand

+

Peptide

NVYGIGTK

Modified Peptide

n[230]NVYGIGTK

Peptide Length

8

ORF Length

62

Open Reading Frame (ORF)

MANDATVKKWLPGKEKLQDIPSKTSSNDEEWCFNSCFKSRHRNNFQRNELGENRNVYGIGTK

Conservation Score

0.993

PhyloCSF Frame 1

-5.245

No. of Spectra

2

CPC Coding Probability

0.0346626

PhyloCSF Frame 2 

-4.635

CNTI Index

noncoding

Max Probability

0.9911

PhyloCSF Frame 3

-5.072

CNTI Score

-0.416022772