McDonnell Genome Institute

Washington University

Transcript

lnc-TRIM38-2:9

Chromosome

chr6

Gene Name

lnc-TRIM38-2

Start

25992739

CPC Label

noncoding

End

26001909

Cancer

LUAD

Strand

+

Peptide

LIEMASHFVAQAGMQWR

Modified Peptide

n[230]LIEM[147]ASHFVAQAGM[147]QWR

Peptide Length

17

ORF Length

38

Open Reading Frame (ORF)

LIEMASHFVAQAGMQWRDLGSPTSTSKARVILPLKSLE

Conservation Score

0.103

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0484598

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9997

PhyloCSF Frame 3

0

CNTI Score

-0.357791017