McDonnell Genome Institute

Washington University

Transcript

lnc-TRIM32-3:1

Chromosome

chr9

Gene Name

lnc-TRIM32-3

Start

116597857

CPC Label

noncoding

End

116623710

Cancer

CRC

Strand

+

Peptide

LGNNNVIDTRCR

Modified Peptide

LGNNNVIDTRCR

Peptide Length

12

ORF Length

38

Open Reading Frame (ORF)

LGNNNVIDTRCRYSDPEMLVCWTKVIEQLHDETTLSLR

Conservation Score

1

PhyloCSF Frame 1

-3.994

No. of Spectra

2

CPC Coding Probability

0.264989

PhyloCSF Frame 2 

-4.543

CNTI Index

noncoding

Max Probability

0.636

PhyloCSF Frame 3

-4.325

CNTI Score

-0.351929137