McDonnell Genome Institute

Washington University

Transcript

lnc-TRIM29-9:10

Chromosome

chr11

Gene Name

lnc-TRIM29-9

Start

119987953

CPC Label

noncoding

End

119988834

Cancer

OV

Strand

-

Peptide

LLWEMDLR

Modified Peptide

n[145]LLWEM[147]DLR

Peptide Length

8

ORF Length

80

Open Reading Frame (ORF)

MILTSLKTPTEEWNQYENTVSSSPCPRTSPWTPRPINNLHTSAHSKTPKIPSSKLLWEMDLRLPPVSLCGSPVIKPLSLL

Conservation Score

0.664

PhyloCSF Frame 1

0

No. of Spectra

19

CPC Coding Probability

0.0816942

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9643

PhyloCSF Frame 3

0

CNTI Score

-0.352414458