McDonnell Genome Institute

Washington University

Transcript

lnc-TRIM29-6:1

Chromosome

chr11

Gene Name

lnc-TRIM29-6

Start

120936101

CPC Label

noncoding

End

120936654

Cancer

CCRC

Strand

-

Peptide

LNIALTSK

Modified Peptide

n[230]LNIALTSK

Peptide Length

8

ORF Length

33

Open Reading Frame (ORF)

LNIALTSKENILACPLVMLQRSWKMWTNTAADD

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0330979

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9947

PhyloCSF Frame 3

0

CNTI Score

-0.308386284