McDonnell Genome Institute

Washington University

Transcript

lnc-TRIM26-2:18

Chromosome

chr6

Gene Name

lnc-TRIM26-2

Start

30274282

CPC Label

noncoding

End

30326478

Cancer

OV

Strand

-

Peptide

IMIMTVFLNLTVK

Modified Peptide

n[145]IM[147]IMTVFLNLTVK

Peptide Length

13

ORF Length

49

Open Reading Frame (ORF)

LPTSFDNIRIMIMTVFLNLTVKNAATQQHCYLWPQAAVSALPWVSSLPV

Conservation Score

0.643

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.302961

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8155

PhyloCSF Frame 3

0

CNTI Score

-0.340407263