McDonnell Genome Institute

Washington University

Transcript

lnc-TRIM16-2:2

Chromosome

chr17

Gene Name

lnc-TRIM16-2

Start

15740095

CPC Label

coding

End

15765820

Cancer

OSCC

Strand

-

Peptide

LASAMGCPLLGR

Modified Peptide

n[145]LASAM[147]GCPLLGR

Peptide Length

12

ORF Length

71

Open Reading Frame (ORF)

LASAMGCPLLGRAWLVSLSSWGSWTPELRKLGTAGQESPRAGVSLCLLTPSRKHRRSLVSMEPSMHSPSLP

Conservation Score

0.074

PhyloCSF Frame 1

0

No. of Spectra

18

CPC Coding Probability

0.947132

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9724

PhyloCSF Frame 3

0

CNTI Score

-0.263536853