McDonnell Genome Institute

Washington University

Transcript

lnc-TRIM16-1:7

Chromosome

chr17

Gene Name

lnc-TRIM16-1

Start

15677574

CPC Label

noncoding

End

15684299

Cancer

OV

Strand

-

Peptide

TAESQDVAVNFTR

Modified Peptide

n[145]TAESQDVAVNFTR

Peptide Length

13

ORF Length

63

Open Reading Frame (ORF)

LIYGKHLVRVLPSEDPALSQKGYLKKENMAALCRTAESQDVAVNFTRKNGENWTLLRESCTGM

Conservation Score

1

PhyloCSF Frame 1

-4.017

No. of Spectra

1

CPC Coding Probability

0.0240862

PhyloCSF Frame 2 

-4.977

CNTI Index

noncoding

Max Probability

0.8206

PhyloCSF Frame 3

-1.874

CNTI Score

-0.378446317