McDonnell Genome Institute

Washington University

Transcript

lnc-TRIM13-7:3

Chromosome

chr13

Gene Name

lnc-TRIM13-7

Start

49937807

CPC Label

noncoding

End

49948545

Cancer

OV

Strand

+

Peptide

SNYHCLLMIVCLENPK

Modified Peptide

n[145]SNYHCLLM[147]IVCLENPK

Peptide Length

16

ORF Length

36

Open Reading Frame (ORF)

LVKRKSNYHCLLMIVCLENPKDSSKELLQQSFRIQN

Conservation Score

0.456

PhyloCSF Frame 1

0

No. of Spectra

13

CPC Coding Probability

0.14838

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8384

PhyloCSF Frame 3

0

CNTI Score

-0.362289643