McDonnell Genome Institute

Washington University

Transcript

lnc-TRIM11-3:2

Chromosome

chr1

Gene Name

lnc-TRIM11-3

Start

228358593

CPC Label

coding

End

228361246

Cancer

OV

Strand

-

Peptide

EGEREGDLLGDR

Modified Peptide

n[145]EGEREGDLLGDR

Peptide Length

12

ORF Length

261

Open Reading Frame (ORF)

MRPLCVRILGSRSPRLCVSWDSSVTKASPSSPSSSPASSMVPSSSRLPMPEAAQSTLPLASTRKTRGSLTPTMAVPWAQASWASSLLLELLELGSPPGVAPGSVKRCPDELLGTSVVGDTPCGPIFFTRTSMVSSTSTHLGWGPESPGRAGEWASASVTYSVGTTGFWPGSASGLRGWPAPGRYSRSGASRPGLSGLAEQREGEREGDLLGDRRWPRGLFTTVVMVSSLGEGGEGPRKDGHSAQDCQGSVRAQVIVPASQQ

Conservation Score

1

PhyloCSF Frame 1

-4.521

No. of Spectra

2

CPC Coding Probability

0.99898

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8976

PhyloCSF Frame 3

13.317

CNTI Score

-0.27891263