McDonnell Genome Institute

Washington University

Transcript

lnc-TRIB2-14:1

Chromosome

chr2

Gene Name

lnc-TRIB2-14

Start

13619431

CPC Label

noncoding

End

13627064

Cancer

OV

Strand

+

Peptide

GGGISLGDMPNVNDK

Modified Peptide

n[145]GGGISLGDMPNVNDK

Peptide Length

15

ORF Length

38

Open Reading Frame (ORF)

LRPVLGWGKGGGISLGDMPNVNDKLMDAAHQHGTCVHM

Conservation Score

0.197

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.179968

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6067

PhyloCSF Frame 3

0

CNTI Score

-0.355745926