McDonnell Genome Institute

Washington University

Transcript

lnc-TRIB2-1:1

Chromosome

chr2

Gene Name

lnc-TRIB2-1

Start

12715414

CPC Label

noncoding

End

12716227

Cancer

BRCA-Luminal A

Strand

+

Peptide

ALQAMHWEGK

Modified Peptide

n[145]ALQAM[147]HWEGK

Peptide Length

10

ORF Length

58

Open Reading Frame (ORF)

MGGGVGRETAAFTWLTEEDSGRPAPWIGPNSAPWRCGCKVLSSLASKALQAMHWEGKN

Conservation Score

0.103

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.132643

PhyloCSF Frame 2 

-3.437

CNTI Index

noncoding

Max Probability

0.9965

PhyloCSF Frame 3

-3.392

CNTI Score

-0.38196599