McDonnell Genome Institute

Washington University

Transcript

lnc-TRIB1-4:3

Chromosome

chr8

Gene Name

lnc-TRIB1-4

Start

126323935

CPC Label

noncoding

End

126332579

Cancer

LUAD

Strand

+

Peptide

LSLCNTTGALPVGAGLLR

Modified Peptide

n[230]LSLCNTTGALPVGAGLLR

Peptide Length

18

ORF Length

39

Open Reading Frame (ORF)

LSLCNTTGALPVGAGLLRRRIDSSYNDFFSPKTIWIDKF

Conservation Score

0.04

PhyloCSF Frame 1

-6.202

No. of Spectra

1

CPC Coding Probability

0.0502672

PhyloCSF Frame 2 

-3.85

CNTI Index

noncoding

Max Probability

0.2939

PhyloCSF Frame 3

-5.305

CNTI Score

-0.385145133