McDonnell Genome Institute

Washington University

Transcript

lnc-TREM1-2:1

Chromosome

chr6

Gene Name

lnc-TREM1-2

Start

41308165

CPC Label

noncoding

End

41308565

Cancer

BRCA-Luminal A

Strand

-

Peptide

VTNPNAK

Modified Peptide

n[145]VTNPNAK

Peptide Length

7

ORF Length

67

Open Reading Frame (ORF)

MLPSGFWNFLVHNVKELEVLLMRSKSYCAEIAHNVSSKDHKAIVERAAQLAIRVTNPNAKLCSEDNE

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0413157

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4866

PhyloCSF Frame 3

0

CNTI Score

-0.30694692