McDonnell Genome Institute

Washington University

Transcript

lnc-TRDMT1-5:3

Chromosome

chr10

Gene Name

lnc-TRDMT1-5

Start

17231002

CPC Label

noncoding

End

17235287

Cancer

OV

Strand

-

Peptide

LCIVILPSNFNDTIEFAK

Modified Peptide

n[145]LCIVILPSNFNDTIEFAK

Peptide Length

18

ORF Length

42

Open Reading Frame (ORF)

LCIVILPSNFNDTIEFAKKKRNLLAPFQLETKFSYLPTRFPF

Conservation Score

0.999

PhyloCSF Frame 1

-4.979

No. of Spectra

1

CPC Coding Probability

0.157142

PhyloCSF Frame 2 

-3.278

CNTI Index

coding

Max Probability

0.9587

PhyloCSF Frame 3

-1.817

CNTI Score

0.625068684