McDonnell Genome Institute

Washington University

Transcript

lnc-TRDMT1-5:1

Chromosome

chr10

Gene Name

lnc-TRDMT1-5

Start

17233324

CPC Label

noncoding

End

17234833

Cancer

OV

Strand

-

Peptide

LVLTVPLRASTSQVRDCTCLR

Modified Peptide

n[145]LVLTVPLRASTSQVRDCTCLR

Peptide Length

21

ORF Length

52

Open Reading Frame (ORF)

LVLTVPLRASTSQVRDCTCLRYSVDSCFAWRRASLFRLAASERFLAATLSYC

Conservation Score

1

PhyloCSF Frame 1

-2.191

No. of Spectra

4

CPC Coding Probability

0.127492

PhyloCSF Frame 2 

13.745

CNTI Index

noncoding

Max Probability

0.5795

PhyloCSF Frame 3

10.384

CNTI Score

-0.322275677