McDonnell Genome Institute

Washington University

Transcript

lnc-TRAPPC6B-2:2

Chromosome

chr14

Gene Name

lnc-TRAPPC6B-2

Start

39265702

CPC Label

noncoding

End

39267061

Cancer

BRCA-Basal-like

Strand

-

Peptide

DQGYVPR

Modified Peptide

n[145]DQGYVPR

Peptide Length

7

ORF Length

131

Open Reading Frame (ORF)

LSCEPHNPKDQGYVPRAPASGGRGGGGGETSPRGVSAQPPPPRPRGRRQAQPRHPRLSFRSLAGACCLRPAEVLTAAYPGRPRQPREASRRRHSSQKNGLRGTRRCALPTTSGLWTLDRKASRLSCGLVRV

Conservation Score

0.958

PhyloCSF Frame 1

0

No. of Spectra

56

CPC Coding Probability

0.0547333

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9956

PhyloCSF Frame 3

-2.384

CNTI Score

-0.289979197