McDonnell Genome Institute

Washington University

Transcript

lnc-TRAPPC6B-1:1

Chromosome

chr14

Gene Name

lnc-TRAPPC6B-1

Start

39174884

CPC Label

noncoding

End

39175880

Cancer

OV

Strand

-

Peptide

LDQVPIPPSPR

Modified Peptide

n[145]LDQVPIPPSPR

Peptide Length

11

ORF Length

37

Open Reading Frame (ORF)

LDQVPIPPSPRRLHVDRKLGCSCKVLTATAIFSLRQA

Conservation Score

1

PhyloCSF Frame 1

-2.18

No. of Spectra

3

CPC Coding Probability

0.0452893

PhyloCSF Frame 2 

6.291

CNTI Index

noncoding

Max Probability

0.8716

PhyloCSF Frame 3

4.485

CNTI Score

-0.294077722