McDonnell Genome Institute

Washington University

Transcript

lnc-TRAPPC6A-3:3

Chromosome

chr19

Gene Name

lnc-TRAPPC6A-3

Start

45238631

CPC Label

noncoding

End

45245370

Cancer

CCRC

Strand

-

Peptide

AGTLPLR

Modified Peptide

n[230]AGTLPLR

Peptide Length

7

ORF Length

138

Open Reading Frame (ORF)

MPILKNLGVSDPKVPRAGTLPLRSSRNPFEEVSGLEEEEAGELGSLPNGTSCRRRATLEKLAGLAPFRLGWAPGRRAGSPGDGQPRSFLGRVLVPGIRRSSADFGLLARLHGTRAHGDEEAAGEAARRLAFLRLGRGS

Conservation Score

1

PhyloCSF Frame 1

14.808

No. of Spectra

21

CPC Coding Probability

0.193504

PhyloCSF Frame 2 

-4.813

CNTI Index

noncoding

Max Probability

0.9992

PhyloCSF Frame 3

-3.817

CNTI Score

-0.26725896